PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0319s0040.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 678aa    MW: 73427.8 Da    PI: 7.0882
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0319s0040.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093764131954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  SapurV1A.0319s0040.3.p 376 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 413
                             554459******************************88 PP

2BELL126.11.3e-40240311172
                    BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             erqe+q+kkakL+s+l+eV++rY+qy++q+q+vissFe++ag+gsak Yt+lAlk+iS++FrcLkdai++qi
  SapurV1A.0319s0040.3.p 240 ERQEIQMKKAKLISMLDEVEQRYRQYHHQMQIVISSFEQAAGIGSAKTYTALALKTISKQFRCLKDAITGQI 311
                             79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-63163309IPR006563POX domain
PfamPF075262.8E-50169308IPR006563POX domain
PROSITE profilePS5007112.195354417IPR001356Homeobox domain
CDDcd000861.40E-12357418No hitNo description
SMARTSM003895.3E-9357421IPR001356Homeobox domain
SuperFamilySSF466896.84E-17358424IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-29360424IPR009057Homeodomain-like
PfamPF059202.8E-18374413IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MATYFHGNPE IQAAAASADG LQTLVLMNPT YVQYSDTPPP PPSNNLVFLN AAASAAANSL  60
SPPPHLSGHG PSNTQQFVGI PLDPNSHEAS ALHGLIPRVH YNFYNPIDSS SARETPRAPQ  120
GLSLSLSSQQ QGSFGSQAQA VSGEDIRASG GFVSPGLGVT NGVPGMQGVL LSSKYLKAAE  180
ELLDEVVNVN SNGIKSELSK KSNGISSNNS NRLIGESSAG EGSGEGEASG KRGPELSTAE  240
RQEIQMKKAK LISMLDEVEQ RYRQYHHQMQ IVISSFEQAA GIGSAKTYTA LALKTISKQF  300
RCLKDAITGQ IKAANKSLGE EDCLGGKTEG SRLKFVDHHL RQQRALQQLG MIQHNAWRPQ  360
RGLPERSVSV LRAWLFEHFL HPYPKDSDKH MLAKQTGLTR SQVSNWFINA RVRLWKPMVE  420
EMYMEEIKEQ EQNGSEDKTS KSEHNEDSAS RSVLQEKGSV NGNQSRSFKS LDNSPDAPSA  480
ISIPTASTSP VGGNLRNQSG FSFMGSSELD GIAQGSPKKP RSHDLIHSPT SVPSINMDIK  540
PGEVNNGQVS MKFGDERQSR DGYSFMGGQT NFIGGFGQYP MGDIGRFDGE QFTPRFSGNG  600
VSLTLGLPHC ENLSLSGTHQ TFLPNQNIQL GRRVEMGEPN EYGALNTSTP HSSTAYESMD  660
IQNRKRFITP LLPDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B1e-16363420158Homeobox protein Meis1
4xrs_A1e-16363420158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT0288670.0CT028867.1 Poplar cDNA sequences.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006381944.10.0hypothetical protein POPTR_0006s21950g
RefseqXP_006381943.10.0hypothetical protein POPTR_0006s21950g
RefseqXP_006381945.10.0hypothetical protein POPTR_0006s21950g
RefseqXP_006381946.10.0hypothetical protein POPTR_0006s21950g
RefseqXP_002308323.20.0hypothetical protein POPTR_0006s21950g
RefseqXP_006381947.10.0hypothetical protein POPTR_0006s21950g
RefseqXP_006381948.10.0hypothetical protein POPTR_0006s21950g
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLB9H9B30.0B9H9B3_POPTR; Uncharacterized protein
STRINGPOPTR_0006s21950.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-171BEL1-like homeodomain 1